PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G113900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 173aa    MW: 19573.7 Da    PI: 11.1296
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G113900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-1276120147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rW +eE++++++a  ++G + Wk+I + +  ++t  q++s+ qk+
  Seita.9G113900.2.p  76 RERWVAEEHDRFLHALVLFGRD-WKRIEAFVA-TKTSTQIRSHAQKH 120
                         78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.76E-1570126IPR009057Homeodomain-like
PROSITE profilePS5129415.60971125IPR017930Myb domain
SMARTSM007171.1E-875123IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.3E-1575123IPR006447Myb domain, plants
PfamPF002498.6E-1076120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-676120IPR009057Homeodomain-like
CDDcd001671.40E-778121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MFTHTLNTGA NSRTLKTQLS PPTGFYLCFF CCSIRKRDRQ SESERDIYTM MMAAPAKSIG  60
MAGKKPRKPY TITRPRERWV AEEHDRFLHA LVLFGRDWKR IEAFVATKTS TQIRSHAQKH  120
FLRAQKLGLS VAPLPHPRRA AAAGVRQADE TIQLPLSPDD PHFALVCRGK AR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986273.23e-84PREDICTED: protein REVEILLE 8-like
SwissprotQ8RWU33e-30RVE8_ARATH; Protein REVEILLE 8
TrEMBLK4AIS42e-80K4AIS4_SETIT; Uncharacterized protein
STRINGSi038786m5e-80(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-27MYB_related family protein